Skip to content

Latest commit

 

History

History
624 lines (401 loc) · 56.5 KB

File metadata and controls

624 lines (401 loc) · 56.5 KB

localCIDER

Version 0.1.18 - December 2020

Introduction

CIDER Classification of Intrinsically Disordered Ensemble Regions is a web-server for calculating various properties of a disordered sequence. CIDER's calculations are carried out by a backend app, called localCIDER.

CIDER is useful if you want to quickly calculate some parameter on the fly. HOWEVER, for doing a large number of sequences, we recommend you instead use localCIDER and carry out the computation locally.

localCIDER vs. CIDER?

localCIDER lets us provide an implicit distributed computing model to all of CIDER's calculations. Think of it this way - if 100 people have 100 sequences, we (the Pappu lab) have the burden of 10,000 calculations to perform. If everyone submitted these sequences at once, the website would slow for everyone, and maybe crash. This is a lot of work for us, and very annoying for you, the user. HOWEVER, by using localCIDER you can take advantage of

  • Your own local infrastructure
  • The ability to programmatically create analysis pipelines
  • The fact you can operate independently of the CIDER web-server

Moreover, if there's a type of analysis you use frequently and you think other users would appreciate, we'd be happy to build this in to localCIDER. Adding new functionality is typically much more involved for a web-app.

Installation

Introduction

localCIDER version 0.1.10 was submitted to PyPI (the Python Package Index) in November 2016. This should be considered a stable release, however, if you encounter any issues/bugs it would be greatly appreciated if you could report any issues to alex.holehouse@wustl.edu.

New Features

  1. Updated the way get_isoelectric_point() works such that the threshold for declaring a sequence as 'uncharged' (when searching for the pI) is based on FCR instead of absolute charge as was done previously (had the unfortunate effect of creating a small length dependence on the pI because the numerical precision depended on the sequence length).

  2. Fixed a bug in the get_molecular_weight() function that failed to account for the loss of H2O in a peptide bond

  3. Added C and Y as titratable residues (pKa = 8.5 and 10.1)

Installing on OSX or linux

We recommend installing using pip. pip is a command line interface for downloading and installing packages from the Python package index (PyPI). If you don't yet have pip installed see the documentation here.

We also recommend virtualenv although this is not at all required, it's just generally a good route to go if you use Python! For more information on virtualenv check out this link

Once pip is installed, localCIDER can be installed by running;

[sudo] pip install localcider 

Very simple! localCIDER depends on the three pillars of scientific Python computing (numpy, scipy, and matplotlib), all of which will be installed via pip if you haven't already installed them.

If you encounter issues installing please let me know. That said, any issues should be due to problems with Numpy or matplotlib and not localCIDER, so investigate the documentation associated with installing those packages first.

Python 2 and Python 3

Python2 is now a deprecated language and full-time localCIDER development is exclusively focussed on maintaining the Python 3 version. Please do not use Python2!

Known installation issues

OpenSuse

pip will not install system level dependencies, so you may need to install additional packages to get matplotlib working with vanilla OpenSuse. Specifically

[sudo] zypper install freetype2-devel
[sudo] zypper install gcc-c++
[sudo] zypper install libpng16-devel
[sudo] zypper install python-numpy-devel

Of course, one or more of these may already be installed, so your best bet is to try installing localcider, and if it fails check these guys are installed by using

zypper search <package-name> # an 'i' next to the package indicates it's installed

An alternative issue may be that installing python-numpy-devel (which is required by pip to build matplotlib) requires numpy-1.7 and you have numpy-1.8. In this case we recommend using

[sudo] zypper install python-matplotlib-tk

To install matplotlib (NOTE the -tk at the end!)

Getting Python packaging and OpenSuse to work together can be a pain, so there are likely alternative solutions to those presented here.

Ubuntu

The issues for OpenSuse are also true for Ubuntu - specifically Ubuntu seems to need the python-dev package to install numpy, and the libfreetype6-dev package for to get Freetype working in matplotlib

[sudo] apt-get install python-dev
[sudo] apt-get install libfreetype6-dev 

Upgrading via pip

localCIDER does not automatically update, but can be updated using pip. To see the historic update schedule see the end of this file.

pip allows you to upgrade packages to the latest version using

[sudo] pip install --upgrade localcider

However, this command will upgrade all the dependencies as well, which may not be a desirable behaviour. To upgrade just localCIDER use

[sudo] pip install -U --no-deps localcider

Alternativly, you can update by uninstalling and re-installing localcider using

pip uninstall localcider
pip install localcider 

Installation on Windows

Tested on Windows 7 64 bit

  1. Download and install Anaconda package (http://continuum.io/downloads)

  2. Download get-pip.py (https://bootstrap.pypa.io/get-pip.py)

  3. Open cmd.exe from start menu (this is windows command prompt)

  4. Change directory to that containing get-pip.py (EX: cd "D:\downloads" )

  5. In cmd.exe run python get-pip.py

  6. In cmd.exe run pip install localcider

  7. Open IPython Notebook from the windows start menu (installed with Anaconda package, other editors can be used i.e. PyCharm)

  8. Write code to use localCIDER package

Using localCIDER

Once you have localCIDER installed, activate the interactive Python prompt (we recommend using iPython and import the localcider package;

import localcider

There are two main localcider modules right now;

  • sequenceParameters which lets you calculate many different parameters, as well as show or save plots relating to a specific sequence - this is the main module of interest
  • plots which lets you plot certain parameters independent of sequenceParameters

Quick-start - calculate kappa of my sequence and plot it on the diagram-of-states.

The following code will print the kappa value of your sequence to the terminal prompt, and then plot your sequence on a diagram-of-states, saving it in the current directory as my_snazzy_plot.png

# import the relevant code
from localcider.sequenceParameters import SequenceParameters

# create a SequenceParameters object with your amino acid sequence
SeqOb = SequenceParameters("DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV")

# carry out analysis
SeqOb.get_kappa() 
SeqOb.save_phaseDiagramPlot('my_snazzy_plot')

# For publications we recommend using vector graphics and saving plots as PDF files 
SeqOb.save_phaseDiagramPlot('my_snazzy_plot', saveFormat='pdf'))

Interactive help

localCIDER contains an extensive set of interactive help information - for any object or function simply type help(<item>) for a complete description. For example;

# import the relevant code
from localcider.sequenceParameters import SequenceParameters

# create a SequenceParameters object with your amino acid sequence
SeqOb = SequenceParameters("MY AMINO ACID SEQUENCE")

help(SeqOb)

help(SeqOb.get_kappa())

General sequence analysis with SequenceParameters

The approach we recommend for accessing SequenceParameters objects is to use the following Python code;

from localcider.sequenceParameters import SequenceParameters

By opening your code with this line, you now have direct access to the SequenceParameters class, which takes either a string of an amino acid sequence or the filename of a file containing an amino acid sequence, which is then read and parsed. As an example;

# as before we import the SequenceParameters class directly
from localcider.sequenceParameters import SequenceParameters

# the sequence below is the first 30 residues from alpha-synuclein
SeqOb = SequenceParameters("MDVFMKGLSKAKEGVVAAAEKTKQGVAEAA")     

Or alternatively

# as before we import the SequenceParameters class directly
from localcider.sequenceParameters import SequenceParameters

# the sequence below is the first 30 residues from alpha-synuclein
SeqOb = SequenceParameters(sequenceFile="syn.fasta")

Both these code snippets create a SequenceParameters object - here that object is called SeqOb, but obviously this variable could be named anything. We can run a huge range of analysis routines on this object. The complete function list is shown below for reference.

Many of these functions don't take arguments. Optional arguments are prefixed with a question mark (?). For each function we use the seqOb.<function> syntax - e.g.

seqOb.get_FCR()

Single value sequence analysis functions

The functions below perform various analysis over sequences and return a single value. NOTE: Where pH values can be provided, if left blank we assume a neutral pH where only R/K/D/E are charged. If a pH value is provided, then R/K/D/E/C/Y/H are all considered titratable residues using EMBOSS pKa values, listed below: 'C': 8.5, 'Y': 10.1, 'H': 6.5, 'E': 4.1, 'D': 3.9, 'K': 10.0, 'R': 12.5

Function name Operation
get_length() Get the sequence length
get_FCR(pH=None) Get the fraction of charged residues in the sequence [4] (pH keyword allows for a pH specific value)
get_NCPR(pH=None) Get the net charge per residue of the sequence [5]
get_isoelectric_point() Get the isoelectric point of the sequence
get_molecular_weight() Get the molecular weight of the protein associated with a given amino acid sequence
get_countNeg() Get the number of negatively charged residues in the sequence (D/E)
get_countPos() Get the number of positively charged residues in the sequence (R/K)
get_countNeut() Get the number of neutral amino acids
get_fraction_negative() Get the fraction of residues which are negatively charged (F-)
get_fraction_positive() Get the fraction of residues which are positively charged (F+)
get_fraction_expanding(pH=None) Get the fraction of residues which are predicted to contribute to chain expansion (E/D/R/K/P)
get_amino_acid_fractions() Get a dictionary of the fractions of each amino acid in the sequence
get_fraction_disorder_promoting() Get the fraction of residues predicted to be 'disorder promoting' [1]. Note this is NOT a disorder prediction!
get_kappa() Get the sequence's kappa value [2]
get_Omega() Get the sequence's Omega value. Omega defines the patterning between charged/proline residues and all other residues 14].
get_mean_net_charge(pH=None) Get the absolute mean net charge of your sequence
get_phase_plot_region() Get the region on the diagram-of-states where your sequence falls [2]
get_mean_hydropathy() Get the mean hydropathy as calculated from a skewed Kyte-Doolittle hydrophobicity scale* [3]
get_uversky_hydropathy() Get the mean hydropathy as calculated from a normalized Kyte-Doolittle hydrophobicity scale** [3,4]
get_PPII_propensity(mode='hilser') Get the overall sequence's PPII propensity as defined by one of three PPII propensity scales. By default, the scale by Elam et al.[6] is used, but modes creamer and kallenbach are also available, which use values from scales by Rucker or Shi, respectively [12,13].
get_delta()
Returns the delta value of the sequence, as defined when calculating kapp [2]
get_deltaMax()
Returns the maximum possible delta value (delta-max) for a sequence of this composition

* The skewed hydrophobicity scale shifts the normal KD scale such that the lowest value is 0 (instead of -4.5) and the highest value is 9 (instead of 4.5)

** The normalized Kyte-Doolittle scale converts all values on the scale to fall between 0 and 1

Position-specific sequence analysis functions

The following functions generate an array of values which describes some property associated with the sequence as a function of sequence position.

Function name Operation
get_linear_FCR(blobLen=5) Returns a 2D numpy array of the fraction of charged residues (FCR) as defined by a sliding window. The first dimension of the 2D array contains the local FCR values and the second contains the associated residue index values along the sequence. the blobLen keyword defines the window size used to calculate the sequence-local FCR. A stepsize of 1 is always used.
get_linear_NCPR(blobLen=5) Returns a 2D numpy array of the net charge per residue (NCPR) as defined by a sliding window. The first dimension of the 2D array contains the local NCPR values and the second contains the associated residue index values along the sequence. The blobLen keyword defines the window size used to calculate the sequence-local NCPR. A stepsize of 1 is always used.
get_linear_sigma(blobLen=5) Returns a 2D numpy array of the linear sigma value as defined by a sliding window. The first dimension of the 2D array contains the local sigma values and the second contains the associated residue index values along the sequence. the blobLen keyword defines the window size used to calculate the sequence-local sigma value. A stepsize of 1 is always used.
get_linear_hydropathy(blobLen=5) Returns a 2D numpy array of the local hydropathy as defined by a sliding window using the Kyte-Doolite hydropathy scale[3]. The first dimension of the 2D array contains the local hydropathy score and the second contains the associated residue index values along the sequence. The blobLen keyword defines the window size used to calculate the sequence-local hydropathy. A stepsize of 1 is always used.
get_linear_complexity(complexityType='WF', alphabetSize=20, userAlphabet={}, windowSize=10, stepSize=1, wordSize=3) Returns the linear sequence complexity as defined by complexityType. Optionally, the sequence complexity of a reduced complexity alphabet can be returned, where that reduced alphabet is defined by either the alphabetSize (which takes advantage of 11 pre-defined simplified alphabets) or via a custom userAlphabet dictionary.

The complexityType Defines the complexity measure being employed. Three different complexity measures are provided by localCIDER, where the measure being used is passed via a string with one of 'WF', 'LC', or 'LZW'. WF is Wooton-Federhen complexity [8], which reports on the sequence's local Shannon entropy, and is the complexity measure used in the SEG algorithm. LC is Linguistic complexity [9], which reports on the number of distinct subsequences over the maximum number of different subsequences given the alphabet size and the word size. Finally, LZW is Lempel-Ziv-Welch [10] complexity, and effectivly asks how efficienctly the sequence can undergo lossless compression using unique subsequences.

The alphabetSize defines the size of the alphabet being used, where pre-defined alphabets are then used based on the specific size. Those pre-defined alphabets are defined below this table for clarity. By default an alphabetSize of 20 is used (i.e. no reduction in amino acid complexity). 'userAlphabet' Allows the user to define their own reduced alphabet. The format here is a dictionary where each key-value pair is amino-acid to X. This means you need a dictionary of length 20 where each amino acid is mapped to another amino acid. This is somewhat of tedious, but it helps avoid user-error where specific amino acids are missed. (default=None).

The blobLen is the sliding window size over which complexity is calculated (default=10). The stepSize is the size of steps taken as we define a new sliding window. Finally, the wordSize keyword is only relevant for the linguistic complexity (LC), ignored for other types, and defines the size of word for the algorithm. Default is 3. We recommend further reading of the associated literature to better understand these complexity measures.
get_linear_sequence_composition(blobLen=5, grps=[]) Returns an X by n matrix, where n is the number of amino acids in the sequence and X is the number of distinct groups of amino acids provided. This functions allows the local amino acid composition to be explored using a sliding window that computes the local density of one or more groups of amino acids along the sequence. The blobLen keyword defines the window size used to calculate the local sequence composition, and a stepsise of 1 is always used. The grps variable defines a list of lists, where each sub-list has elements that are amino acids. If no groups are provided a default grouping of amino acids by their physiochemical properties are used, i.e. grps = [['E','D'], ['R','K'], ['R','K','E','D'], ['Q','N','S','T','G','H', 'C'], ['A','L','M','I','V'], ['F','Y','W'], ['P']], where groupsings are negativly charged, positivly chagred, charged, polar, aliphatic, aromatic, proline.
get_Omega_sequence() Returns the reduced-alphabet sequence used to calculate the Omega parameter, where by R/K/D/E/P residues are defined as 'X' and all other residues are 'O'. This provides a clear visual description of the charge/proline patterning.

Reduced alphabets

Predefined alphabets shown below - all except eleven are based on alphabets defined in the reference below [11].

two      - [(LVIMCAGSTPFYW), (EDNQKRH)]
three    - [(LVIMCAGSTP), (FYW), (EDNQKRH)]
four     - [(LVIMC), (AGSTP), (FYW), (EDNQKRH)]
five     - [(LVIMC), (ASGTP), (FYW), (EDNQ), (KRH)]
six      - [(LVIM), (ASGT), (PHC), (FYW), (EDNQ), (KR)]
eight    - [(LVIMC), (AG), (ST), (P), (FYW), (EDNQ), (KR), (H)]
ten      - [(LVIM), (C), (A), (G), (ST), (P), (FYW), (EDNQ), (KR), (H)]
eleven   - [(LVIM), (C), (A), (G), (ST), (P), (FYW), (ED), (NQ), (KR), (H)]
twelve   - [(LVIM), (C), (A), (G), (ST), (P), (FY), (W), (EQ), (DN), (KR), (H)]
fifteen  - [(LVIM), (C), (A), (G), (S), (T), (P), (FY), (W), (E), (Q), (D), (N), (KR), (H)]
eighteen - [(LM), (VI), (C), (A), (G), (S), (T), (P), (F), (Y), (W), (E), (D), (N), (Q), (K), (R), (H)]
twenty   - all twenty!

Phosphorylation functions

The following functions augment your sequence to consider the impact of phosphorylation on the electrostatic properties. Note this makes the highly simplifying assumption that the phosphorylation of a Ser/Thr/Tyr residue simply adds a negative charge to your protein chain. In reality, many other properties of the chain are impacted by phosphorylation than simply the linear charge patterning.

Function name Operation
get_all_phosphorylatable_sites() Get a list of the positions of all Ser/Thr/Tyr residues. Note this function DOES NOT make any inference about accessibility or binding/recognition motifs, it's literally just a list of sites which canonically are able to be phosphorylated.
set_phosphosites(list_of_positions) Sets a residues which may be phosphorylatable (must be T/Y/S). Note this can be called multiple times, and will only set sites which are T/Y/S)
get_phosphosites() Get the list of sites currently designated as phosphosites by set_phosphosites
clear_phosphosites() Clears any previously defined phosphosites
get_kappa_after_phosphorylation() Get the kappa value assuming full phosphorylation (with H2PO4-1).
get_phosphosequence() Returns the fully phosphorylated sequence, with "phosphorylated residues" replaced with glutamate (E)
get_full_phosphostatus_kappa_distribution() For each possible phospho-permutant, given the available phosphosites, calculate the kappa, fraction positive, fraction negative, FCR, NCPR, mean hydropathy and the phosphostatus. Phosphostatus is itself a tuple, where each position defines the phosphorylation status of each consecutive phosphosite in the sequence; 0 indicates unphosphorylated and 1 indicates phosphorylated.

The function call returns a list of tuples, where each tuple contains the information described for each unique phospho-permutant. The assumption currently being made is that phosphorylation introduces a -1 charge only. While this may not be fully accurate, it provides a good and simple first approximation for the effect of phosphorylation. Also note that as the number of phosphosites increases the number of calculations here scales as n^2. Be warned!

Miscellaneous functions

The functions below represent a variety of miscellaneous functions.

Function name Operation
get_HTMLColorString()
Returns a fully formated HTML string which can be used to represent your sequence. The coloring used has a default, but can be defined using the set_HTMLColorResiduePalette function
set_HTMLColorResiduePalette(colorDictionary)
Allows you to custom define a colour pallete. The colorDictionary must be a dictionary object that maps each of the 20 amino acids to a color. Currently 17 possible colors can be assigned to the 20 amino acids. These are;
aqua, black, blue, fuchsia, gray, green, lime, maroon, navy, olive, orange, purple, red, silver, teal, white, and yellow. This set of 17 colors represents the HTML browser compatible set of colors.

Sequence permutation functions

These functions perform some operation on the sequence, returning a permuted SequenceParameter object populated with a different sequence. The underlying sequence object the function is called on is not altered.

Function name Operation
get_shuffle(frozen=None)
Returns a SequenceParameter object with the primary amino acid sequence shuffled. If residue index positions are past as a list to 'frozen' those residues are considered imutable and are not shuffled.

Plotting functions (on-screen 'show' functions)

The following functions let you plot parameters from your sequence and display the results immediately on screen.

Function name Operation
show_phaseDiagramPlot(label="", title='Diagram of states', legendOn=True, xLim=1, yLim=1, fontSize=10, getFig=False) Renders a matplotlib diagram-of-states plot with your sequence on the diagram[2]. If a label is provided this is a string which annotates your sequence on the plot. If a title is provided this sets the plot title. legendOn defines if the region labels are included as a legend. xLim and yLim define the max values for the X and Y axes. fontSize defines the size of the label font. getFig defines if a matplotlib object is returned instead of being rendered on screen.
show_uverskyDiagramPlot(label="", title='Uversky Plot', legendOn=True, xLim=1, yLim=1, fontSize=10, getFig=False) Renders a matplotlib Uversky plot with your sequence on the diagram[4]. label can be a string which labels your sequence on the plot. If a title is provided this sets the plot title. legendOn defines if the regions labels are included as a legend. xLim and yLim define the max values for the X and Y axes. fontSize defines the size of the label font. getFig defines if a matplotlib object is returned instead of being rendered.
show_linearHydropathy(blobLen=5, getFig=False) Renders a matplotlib plot of the moving average hydropathy along the sequence, where the hydropathy is calculated in overlapping windows of size blobLen. Typically a blob length of 5-7 is used. getFig defines if a matplotlib object is returned instead of being rendered.
show_linearNCPR(blobLen=5, getFig=False) Renders a matplotlib plot of the moving average net charge per residue (NCPR) along the sequence, where the NCPR is calculated in overlapping windows of size blobLen. Typically a blob length of 5-7 is used. getFig defines if a matplotlib object is returned instead of being rendered.
show_linearFCR(blobLen=5, getFig=False) Renders a matplotlib plot of the moving average fraction of charged residues (FCR) along the sequence, where the FCR is calculated in overlapping windows of size blobLen. Typically a blob length of 5-7 is used. getFig defines if a matplotlib object is returned instead of being rendered.
show_linearSigma(blobLen=5, getFig=False) Renders a matplotlib plot of the moving average sigma parameter along the sequence, where sigma is calculated in overlapping windows of size blobLen. Typically a blob length of 5-7 is used. Recall that sigma is calculated as the NCPR2 / FCR. getFig defines if a matplotlib object is returned instead of being rendered.
show_linearComplexity(complexityType='WF', alphabetSize=20, userAlphabet={}, windowSize=10, stepSize=1, wordSize=3, getFig=False) Renders a matplotlib plot of the linear sequence complexity. For a discussion of the various options see the get_linear_complexity description under the SequenceParameters functions table. getFig defines if a matplotlib object is returned instead of being rendered.

Plotting functions (file-creating 'save' functions)

The following functions let you plot parameters from your sequence and save those plots to file for future use.

Function name Operation
save_phaseDiagramPlot(filename, label='', title='Diagram of states', legendOn=True, xLim=1, yLim=1, fontSize=10, saveFormat='png') Generates a matplotlib diagram-of-states plot which is then saved to disk. filename is required and defines the file to be saved. Adding extensions is recommended but not required. All options are the same as in show_phaseDiagramPlot, with the addition of the saveFormat keyword, which defines the output format - this parameter is passed to matplotlibs savefig command which supports the following filetypes: emf, eps, pdf, png, ps, raw, rgba, svg, svgz. (DEFAULT = png)
save_uverskyPlot(filename, label='', title='Uversky plot', legendOn=True, xLim=1, yLim=1, fontSize=10, saveFormat='png') Generates a matplotlib Uversky plot with your sequence on the diagram[4] which is then saved to disk. filename is required and defines the file to be saved. Adding extensions is recommended but not required. All options are the same as in show_uverskyPlot, with the addition of the saveFormat keyword, which defines the output format - this parameter is passed to matplotlibs savefig command which supports the following filetypes: emf, eps, pdf, png, ps, raw, rgba, svg, svgz. (DEFAULT = png)
save_linearHydropathy(filename, blobLen=5, saveFormat='png') Renders a matplotlib plot of the moving average hydropathy along the sequence, where the hydropathy is calculated in overlapping windows of size blobLen. Typically 5-7 is used. The plot is saved in the filename location. Adding extensions is recommended but not required. The saveFormat keyword defines the output format - this parameter is passed to matplotlibs savefig command which supports the following filetypes: emf, eps, pdf, png, ps, raw, rgba, svg, svgz.
save_linearNCPR(filename, blobLen=5, saveFormat='png') Renders a matplotlib plot of the moving average net charge per residue (NCPR) along the sequence, where the NCPR is calculated in overlapping windows of size blobLen. Typically 5-7 is used. The plot is saved in the filename location. Adding extensions is recommended but not required. The saveFormat keyword defines the output format - this parameter is passed to matplotlibs savefig command which supports the following filetypes: emf, eps, pdf, png, ps, raw, rgba, svg, svgz.
save_linearFCR(filename, blobLen=5, saveFormat='png') Renders a matplotlib plot of the moving average fraction of charged residues (FCR) along the sequence, where the FCR is calculated in overlapping windows of size blobLen. Typically 5-7 is used. The plot is saved in the filename location. Adding extensions is recommended but not required. The saveFormat keyword defines the output format - this parameter is passed to matplotlibs savefig command which supports the following filetypes: emf, eps, pdf, png, ps, raw, rgba, svg, svgz.
save_linearSigma(filename, blobLen=5, saveFormat='png') Renders a matplotlib plot of the moving sigma value, where sigma defines the local charge assymetry and is used in the calculation of kappa. Sigma is calculated over blobs of blobLen size, typically with blobs of 5-7 residues. The plot is saved in the filename location. Adding extensions is recommended but not required. The saveFormat keyword defines the output format - this parameter is passed to matplotlibs savefig command which supports the following filetypes: emf, eps, pdf, png, ps, raw, rgba, svg, svgz.
save_linearComplexity(filename, complexityType='WF', alphabetSize=20, userAlphabet={}, windowSize=10, stepSize=1, wordSize=3, saveFormat='png') Renders a matplotlib plot of the linear sequence complexity. For a discussion of the various options see the get_linear_complexity description under the SequenceParameters functions table. The plot is saved in the filename location. Adding extensions is recommended but not required. The saveFormat keyword defines the output format - this parameter is passed to matplotlibs savefig command which supports the following filetypes: emf, eps, pdf, png, ps, raw, rgba, svg, svgz.
save_linearCoposition(filename, blobLen=5, saveFormat='png', title='', plot_data=False)) Renders a matplotlib plot of the local, position-specific amino acid composition. In version 0.1.9 the only grouping is the standard physiochemical grouping of amino acids, but in future versions we plan to add customizable groups to the plotting functions (customizable groups are available in the equivalent analysis function get_linear_sequence_composition). The local density is initially calculated and the fit to a univariate spline to remove noise and make the local sequence features more easily identifiable. If the plot_data variable is set to true the raw data is plotted alongside this spline fit, to ensure the fitting procedure is capturing the relevant sequence features. The plot is saved in the filename location. Adding extensions is recommended but not required. The saveFormat keyword defines the output format - this parameter is passed to matplotlibs savefig command which supports the following filetypes: emf, eps, pdf, png, ps, raw, rgba, svg, svgz.

Plotting with the plots module

The plots module lets you generate or save plots without explicitly invoking sequenceParameters objects. Such plots can either be generated using the raw values, or by passing in sequenceParameters objects.

Unlike the SequenceParameters, plots is a collection of functions, and does not allow for the creation of Plots objects.

In the following discussion a single plot contains information from just one sequence, whereas a multiple plot contains sequence information from many sequences

Using Plots functions

There are two modes with which you can use plots functions;

Passing raw parameters to be plotted (single and multiple plots)

This may be convenient if you're plotting previously calculated values, or plotting a theoretical distribution here. Either individual values or lists of values can be passed.

Passing SequenceParameters objects (multiple plots only)

If you're analyzing a set of SequenceParameters objects you may wish to place them on the same plot. Note we do not offer this functionality for single sequences, because you can always plot a single sequence using the associated SequenceParameters function (e.g. .show_uverskyPlot() or .save_phaseDiagramPlot()).

Function name Input Arguments Discussion
show_single_phasePlot(fp, fn, label='', title='Diagram of states', legendOn=True, xLim=1, yLim=1, fontSize=10, getFig=False) fp is the fraction of positive residues in a sequence, fn is the fraction of negative residues in a sequence. label, if included, should be a string with which the sequence on the plot is labelled. title, if provided, sets the plot title. legendOn defines if the 5-region legend for the phase diagram plot is included. xLim and yLim define the max values for the X and Y axes. fontSize defines the size of the label font. getFig defines if a matplotlib object is returned instead of being rendered. No programatic output is generated, but the plot is rendered on the screen. If getFig is set to True then the matplotlib object is returned, rather than rendered on the screen.
show_single_uverskyPlot(hydropathy, mean_net_charge, label='', title='Uversky plot', legendOn=True, xLim=1, yLim=1, fontSize=10, getFig=False) hydropathy is the sequence's 0-1 normalized hydropathy, while mean_net_charge is the the absolute value of the sequence's mean net charge. label, if included, should be a string with which the sequence on the plot is labelled. title, if provided, sets the plot title. legendOn defines if the 5-region legend for the phase diagram plot is included. xLim and yLim define the max values for the X and Y axes. fontSize defines the size of the label font. getFig defines if a matplotlib object is returned instead of being rendered. No programatic output is generated, but the plot is rendered on the screen. If getFig is set to True then the matplotlib object is returned, rather than rendered on the screen.
save_single_phasePlot(fp, fn, filename, label='', title='Diagram of states', legendOn=True, xLim=1, yLim=1, fontSize=10) fp is the fraction of positive residues in a sequence, fn is the fraction of negative residues in a sequence. filename is the name of the file to save the plot as (.png is appended). label, if included, should be a string with which the sequence on the plot is labelled. title, if provided, sets the plot title. legendOn defines if the 5-region legend for the phase diagram plot is included. xLim and yLim define the max values for the X and Y axes. fontSize defines the size of the label font. No programatic output is generated, but the plot is constructed and saved at the filename location.
save_single_uverskyPlot(hydropathy, mean_net_charge, filename, label='', title='Uversky plot', legendOn=True, xLim=1, yLim=1, fontSize=10) hydropathy is the sequence's 0-1 normalized hydropathy, while mean_net_charge is the the absolute value of the sequence's mean net charge. filename is the name of the file to save the plot as (.png is appended). label, if included, should be a string with which the sequence on the plot is labelled. title, if provided, sets the plot title. legendOn defines if the 5-region legend for the phase diagram plot is included. xLim and yLim define the max values for the X and Y axes. fontSize defines the size of the label font. No programatic output is generated, but the plot is constructed and saved at the filename location.

If you wish to plot a single sequence's diagram-of-states plot or Uversky plot from a SequenceParameters object we suggest using the appropriate SequenceParameters functions (e.g. .show_uverskyDiagram(), .show_phaseDiagram())

*_multiple*_ functions

For the multiple plotting functions, we pass in a list of values or objects corresponding to the multiple sequences of interest.

There are two types of multiple plots

1) Those which you pass two lists of the actual values of interest, where the lists represent parallel lists, where the position in each list corresponds to a specific sequence. 2) Those which you pass a list of SequenceParameters objects to, meaning you only pass it a single list

The show_* functions render a plot on the screen in front of you through matplotlib. These are useful for directly interacting with sequences and examining how specific sequence might behave. You can also directly access the matplotlib object through the getFig argument.

The save_* functions save a plot to the designated file name.

Function name Input Arguments Discussion
show_multiple_phasePlot(fp_list, fn_list, label_list=[""], title="Diagram of states", legendOn=True, xLim=1, yLim=1, fontSize=10, getFig=False) fp_list and fn_list are lists of the positive fraction and negative fraction of sequences, where the list position in each of these two 'parallel' lists corresponds to the same sequence. That is to say, if you were looking at 5 sequences, fp_list and fn_list would both be of length 5, and fp_list[2] and fn_list[2] would represent the fraction position and fraction negative of your third sequence, respectively. label_list, if included, should be a list of strings corresponding to the length of fn_list and fp_list, and includes names for each sequence on the plot. title, if provided, sets the plot title. legendOn defines if the 5-region legend for the phase diagram plot is included. xLim and yLim define the max values for the X and Y axes. fontSize defines the size of the label font. If getFig is set to True then the matplotlib object is returned, rather than rendered on the screen. No programatic output is generated, but the plot is rendered to the screen.
show_multiple_phasePlot2(SeqParam_list, label_list=[""], title='Diagram of states', legendOn=True, xLim=1, yLim=1, fontSize=10, getFig=False) All arguments are the same as above, except now instead of explicit fraction of positive and fraction of negative lists, we have a single list containing SequenceParameters objects, from which these properties are derived. No programatic output is generated, but the plot is rendered to the screen.
show_multiple_uverskyPlot(hydropathy_list, mean_net_charge_list, label_list=[""], title='Uversky plot', legendOn=True, xLim=1, yLim=1, fontSize=10, getFig=False) hydropathy_list and mean_net_charge_list are lists of the 0-1 normalized hydropathy and the absolute mean net charge, where the list position in each of these two 'parallel' lists corresponds to the same sequence. filename is the name of the file to save the plot as (.png is appended). label_list, if included, should be a list of strings corresponding to the length of fn_list and fp_list, and includes names for each sequence on the plot. title, if provided, sets the plot title. legendOn defines if the 5-region legend for the phase diagram plot is included. xLim and yLim define the max values for the X and Y axes. fontSize defines the size of the label font. If getFig is set to True then the matplotlib object is returned, rather than rendered on the screen. No programatic output is generated, but the plot is rendered to the screen.
show_multiple_uverskyPlot2(SeqParam_list, label_list=[""], title='Uversky plot', legendOn=True, xLim=1, yLim=1, fontSize=10, getFig=False) All arguments are the same as above, except now instead of having an explicit hydropathy list and an explicit mean net charge list, we have a single list containing SequenceParameters objects, from which these properties are derived. No programatic output is generated, but the plot is rendered to the screen.
save_multiple_phasePlot(fp_list, fn_list, filename, ?label_list=[""], ?title="Diagram of states", ?legendOn=True, ?xLim=1, ?yLim=1,?fontSize=10) fp_list and fn_list are lists of the positive fraction and negative fraction of sequences, where the list position in each of these two 'parallel' lists corresponds to the same sequence. That is to say, if you were looking at 5 sequences, fp_list and fn_list would both be of length 5, and fp_list[2] and fn_list[2] would represent the fraction position and fraction negative of your third sequence, respectively. filename is the name of the file to save the plot as (.png is appended). label_list, if included, should be a list of strings corresponding to the length of fn_list and fp_list, and includes names for each sequence on the plot. title, if provided, sets the plot title. legendOn defines if the 5-region legend for the phase diagram plot is included. xLim and yLim define the maximum values for the fraction of negative and positive residues. fontSize defines the size of the label font. No programatic output is generated, but the plot is constructed and saved at the filename location.
save_multiple_phasePlot2(SeqParam_list, filename, label_list=[""], title='Diagram of states', legendOn=True, ?xLim=1, ?yLim=1,?fontSize=10) All arguments are the same as above, except now instead of explicit fraction of positive and fraction of negative lists, we have a single list containing SequenceParameters objects, from which these properties are derived. No programatic output is generated, but the plot is constructed and saved at the filename location.
save_multiple_uverskyPlot(hydropathy_list, mean_net_charge_list, filename, label_list=[""], title='Uversky plot', legendOn=True, xLim=1, yLim=1, fontSize=10) hydropathy_list and mean_net_charge_list are lists of the 0-1 normalized hydropathy and the absolute mean net charge, where the list position in each of these two 'parallel' lists corresponds to the same sequence. filename is the name of the file to save the plot as (.png is appended). label_list, if included, should be a list of strings corresponding to the length of fn_list and fp_list, and includes names for each sequence on the plot. title, if provided, sets the plot title. legendOn defines if the 5-region legend for the phase diagram plot is included. xLim and yLim define the maximum values for the fraction of negative and positive residues. fontSize defines the size of the label font. No programatic output is generated, but the plot is constructed and saved at the filename location.
save_multiple_uverskyPlot2(SeqParam_list, filename, label_list=[""], title='Uversky plot', legendOn=True, xLim=1, yLim=1, fontSize=10) All arguments are the same as above, except now instead of having an explicit hydropathy list and an explicit mean net charge list, we have a single list containing SequenceParameters objects, from which these properties are derived. No programatic output is generated, but the plot is constructed and saved at the filename location.

localcider exceptions

If you're into exception handling, localcider has a set of defined exceptions (all of which inherits from the Exception base class) which can be access by importing localcider - i.e.

import localcider

localcider.SequenceFileParserException
localcider.SequenceException
localcider.ResTableException
localcider.PlottingException

There are a couple more but these relate to functionality not yet available in version 0.1.9

Tutorials

1) Calculate a bunch of parameters associated with a sequence I found on the internet

from localcider.sequenceParameters import SequenceParameters

# define my internet sequence and create a new SequenceParameters object with it
internetSequence="VAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP"
object=SequenceParameters(internetSequencexs)


# Let's get some parameters!
object.get_kappa()                       # 0.1960

object.get_fraction_negative()           # 0.1818

object.get_fraction_positive()           # 0.0909

object.get_fraction_disorder_promoting() # 0.75

object.get_amino_acid_fractions()        # {'A': 0.136,
                                         #  'C': 0.0,
                                         #  'D': 0.0682,
                                         #  'E': 0.1136,
                                         #  'F': 0.0227,
                                         #  'G': 0.1364,
                                         #  'H': 0.0,
                                         #  'I': 0.0455,
                                         #  'K': 0.0909,
                                         #  'L': 0.0455,
                                         #  'M': 0.0227,
                                         #  'N': 0.0227,
                                         #  'P': 0.0682,
                                         #  'Q': 0.0682,
                                         #  'R': 0.0,
                                         #  'S': 0.0227,
                                         #  'T': 0.0455,
                                         #  'V': 0.0909,
                                         #  'W': 0.0,
                                         #  'Y': 0.0}
2) Get a list of kappa values for a directory of fasta files.

fasta files are defined as having the following structure

> Header, preceded by a '>' character
SEQUENCESEQUENCESEQUENCESEQUENCESEQUENCESEQUENCE
SEQUENCESEQUENCESEQUENCESEQUENCESEQUENCESEQUENCE
SEQUENCESEQUENCESEQUENCESEQUENCESEQUENCESEQUENCE

Let's imagine we have a directory with 10 fasta files (seq0.fasta, seq1.fasta, ..., seq9.fasta). The following script will calculate the kappa of all such sequences

# import a few things...
import os
from localcider.sequenceParameters import SequenceParameters

# filelist is now a list of each file in the current directory
filelist = os.listdir(".")

# create an empty list 
list_of_SeqObjs = []

# populate that list with SequenceParameters objects, which we construct from the
# sequence found in each file
for file in filelist:
   list_of_SeqObjs.append(SequenceParameters(sequenceFile=file))

# for each 
for obj in list_of_SeqObjs:
   print obj.get_kappa()

Uh oh! One of our sequence files has an amino acid "X" in it - this isn't a canonical amino acid, so triggers a SequenceFileParserException. We actually just want to skip any such files, so we change the code above slightly. Specifically, let's change the for-loop that loops over each file;

# import a few things...
import os
from localcider.sequenceParameters import SequenceParameters

## NOTE - we now import the whole localcider module to give us access
## to the exception classes
import localcider

# get a list of all files in the current directory
filelist = os.listdir(".")

# create an empty list 
list_of_SeqObjs = []

# populate that list with sequenceParameters objects, which we construct from the
# sequence found in each file
for file in filelist:
   list_of_SeqObjs.append(SequenceParameters(sequenceFile=file))
   
   
# populate that list with SequenceParameters objects, which we construct from the
# sequence found in each file
for file in filelist:
   try:
      list_of_SeqObjs.append(SequenceParameters(sequenceFile=file))
   except localcider.SequenceFileParserException:
      # if we encounter a file parsing error just skip that sequence
      continue

Example 3 - plotting two sequence on a single diagram-of-states

# import the plots module
from localcider import plots

# import the SequenceParameters class from the sequenceParameters class
from localcider.sequenceParameters import SequenceParameters    

# create two SequenceParameters objects
SynWT=SequenceParameters("MDVFMKGLSKAKEGVVAAAEKTKQGVAEAA")
SynMut=SequenceParameters("MDVFMKGLSKAKEGEEKKAEKTKQGVAEAA")


# showing with sequence labels
plots.show_multiple_phasePlot2([SynWT, SynMut],label_list=['WT','MUT'])

# saving without
plots.save_multiple_uverskyPlot2([SynWT, SynMut], 'example', label_list=['WT','MUT'])

FAQ

  1. I get a kappa value greater than 1?!

kappa is a ratio of your sequence's delta over the maximium possible value for a sequence of that composition. The original mechanism for computing what the maximum delta value is was using Monte Carlo simulations, but this is extremely computationally expensive. To avoid this we have developed a new deterministic algorithm that uses a number of rule-based heuristics. During early testing of these heuristics there were examples of kappa values being greater than 1, which indicates that these heuristics have failed. As of Fall 2015 we have run many millions of disordered sequences without encountering sequences with a kappa > 1. However, should you encounter a sequence with a kappa value greater than 1 PLEASE email the sequence to me, as it represents a very rare edge case that we haven't encountered in our testing procedures.

  1. I want to run localCIDER on my cluster but it has not graphical frontend and I can't get matplotlib to work

There is a plan to release a higher performance version of localCIDER which carries out the core functionality using C++. However, that's a way off, so for now a quick hack is to do the following;

* Download the sourcecode and unpack - this will be a local package, and means you don't have to instal localCIDER globally
* Move your local package to where you want to carry out the analysis
* Edit localcider/backend/plotting.py and comment out the two import lines which reference matplotlib
* Run your analysis

If you call any functions which depend on matplotlib this will obviously fail, but if not it'll work just fine.

Epilog

Feature request

We'd like localCIDER to be the single-software solution for sequence analysis. To this end, if you have analysis routines you would like to be incorporated used please contact us about adding these into localCIDER. If you can provide us with Python code for performing the analysis in question, we can almost guarentee incorporation into the next version of localCIDER.

About

localCIDER was developed in the Pappu lab by Alex Holehouse, with additional code by James Ahad and Mary Richardson. Many of the early ideas were pioneered by Dr. Rahul Das.

We believe scientific software should be held to same (or higher) software standards as general commercial and open source projects. To this end we use Git for version control, employ standard conventions for versioning, run an ever-expanding set of unit tests, and try to ensure all code is well structured and well documented. The source code is fully open and can be viewed here.

References

[1] Campen, A. et al. TOP-IDP-scale: a new amino acid scale measuring propensity for intrinsic disorder. Protein Pept. Lett. 15, 956–963 (2008).

[2] Das, R. K. & Pappu, R. V. Conformations of intrinsically disordered proteins are influenced by linear sequence distributions of oppositely charged residues. Proc. Natl. Acad. Sci. U. S. A. 110, 13392–13397 (2013).

[3] Kyte, J. & Doolittle, R. F. A simple method for displaying the hydropathic character of a protein. J. Mol. Biol. 157, 105–132 (1982).

[4] Uversky, V. N. Natively unfolded proteins: a point where biology waits for physics. Protein Sci. 11, 739–756 (2002).

[5] Mao, A. H., Crick, S. L., Vitalis, A., Chicoine, C. L. & Pappu, R. V. Net charge per residue modulates conformational ensembles of intrinsically disordered proteins. Proc. Natl. Acad. Sci. U. S. A. 107, 8183–8188 (2010).

[6] Elam WA, Schrank TP, Campagnolo AJ, Hilser VJ. Evolutionary conservation of the polyproline II conformation surrounding intrinsically disordered phosphorylation sites. Protein Sci. 2013; 22: 405- 417. doi: 10.1002/pro.2217 PMID: 23341186

[7] Tomasso, M. E., Tarver, M. J., Devarajan, D. & Whitten, S. T. Hydrodynamic Radii of Intrinsically Disordered Proteins Determined from Experimental Polyproline II Propensities. PLoS Comput. Biol. 12, e1004686 (2016).

[8] Wootton, J. C., & Federhen, S. (1993). Statistics of local complexity in amino acid sequences and sequence databases. Computers & Chemistry, 17(2), 149-163.

[9] Troyanskaya, O. G., Arbell, O., Koren, Y., Landau, G. M., & Bolshoy, A. (2002). Sequence complexity profiles of prokaryotic genomic sequences: a fast algorithm for calculating linguistic complexity. Bioinformatics , 18(5), 679 - 688.

[10] Lempel, A.& Ziv, J. (1976). On the complexity of finite sequence. IEEE Trans. Inf. Theory, vol. IT-22, no. 1, 75-81.

[11] Murphy, L. R., Wallqvist, A., & Levy, R. M. (2000). Simplified amino acid alphabets for protein fold recognition and implications for folding. Protein Engineering, 13(3), 149-152.

[12] Rucker, A.L., Pager, C.T., Campbell, M.N., Qualls, J.E., and Creamer, T.P. (2003). Host-guest scale of left-handed polyproline II helix formation. Proteins 53, 68-75.

[13] Shi, Z., Chen, K., Liu, Z., Ng, A., Bracken, W.C., and Kallenbach, N.R. (2005). Polyproline II propensities from GGXGG peptides reveal an anticorrelation with beta-sheet scales. Proc. Natl. Acad. Sci. U. S. A. 102, 17964-17968.

[14] Martin, E.W., Holehouse, A.S., Grace, C.R., Hughes, A., Pappu, R.V., and Mittag, T. (2016). Sequence determinants of the conformational properties of an intrinsically disordered protein prior to and upon multisite phosphorylation. J. Am. Chem. Soc. 138, 15323-15335.

Thanks

Many people have been involved in this project. We'll try and include an up-to-date list here;

  • Paul Nobrega (University of Massachusetts) for bug reports and the Windows installation instructions
  • Davide Mercadante (Heidelberger Institut fur Theoretische Studien) for bug reports and code development to improve plotting customization
  • Katra Kolsek (Heidelberger Institut fur Theoretische Studien) for bug reports and code development to improve plotting customization
  • Alex Chin (Johns Hopkins University) for a crucial bug report
  • Thomas Pranzatelli (Washington University in St. Louis) for testing and bug reports
  • Carlos Hernández (Stanford University) for Python 3 support and PEP8 compliance
  • Luke Wheeler (University of Oregon) for Python 3 testing
  • Xiaohan Li (Yale University) for corrections to text
  • Sean Cascarina (Colorado State University) for finding a bug where stop-codons are not dealt with correctly in FASTA files
  • David Sanders and Anastasia Repouliou (Princeton University) for the suggestion of introducing pH dependent charge analysis and bug reports
  • Alex Keely for various updates
  • John Bollinger for major updates to Python3 compatibility, bug fixes, error correction.

Update schedule

  • version 0.1.0 - August 10th 2014: Initial release
  • version 0.1.1 - August 14th 2014: Minor bug fixes, more tests, improved sequence parsing
  • version 0.1.2 - October 1st 2014: More tests, fixed heuristic bugs in extreme kappa sequences, significant improvement on plotting customization, cleaned up docs and code documentation
  • version 0.1.3 - October 13th 2014: More tests, corrected a bug introduced in 0.1.2 for sequences with no neutral residues, corrected a bug in how titles/labels were assigned by default, improved how classification into the 5 regions is done, and explicitly allow for regions 4 (positive electrolytes) and 5 (negative electrolytes) rather than general polyelectrolytes
  • version 0.1.4 - January 16th 2015: Corrected bug in the way KD hydrophobicity was calculated - alanine incorrectly set to 0
  • version 0.1.7 - February 25th 2015: Bunch of additional updates and code readability improvements, as well as changing how NCPR/FCR plots are made (bar instead of line)
  • version 0.1.8 - March 28th 2016: Major update with a number of additional features. All figures can now be generated as PDFs, sequence complexity analysis has been added, PPII propensity added, kappa-P added. Pleasantly, no bugs needed fixing, however!
  • version 0.1.9 - September 31st 2016: Added local amino acid composition, general patterning parameter, and improved plot formatting
  • version 0.1.10 - Explicit sequence shuffling with residue freezing, Omega code update, additional PPII scales, updated references, updated plotting functions, font sizes fixed, tests updated, (dynamic rescaling of font size and line-widths)
  • version 0.1.11 - Update to colors for amino acid output string, added the get_linear_sigma function, moved the import location for the scipy dependency so it can
  • version 0.1.12 - Deal with stop codons when reading fasta files. Introduced pH dependence analysis.
  • version 0.1.13 - Added get_molecular_weight() function, fixed a bug for low or high charge sequences with get_isoelectric_point()
  • version 0.1.14 - Updates by Andrew Lyon to Wang Landau sampling algorithm
  • version 0.1.16 - Updated by Alex Keely to fix a few issues
  • version 0.1.17 - Lots of error fixes and full conversion to Python3 by John Bollinger
  • version 0.1.18 – Minor updates

    <ul>
      <li><a href="https://github.com/Pappulab/localCIDER">View On <strong>GitHub</strong></a></li>
      <li><a href="http://pappulab.wustl.edu">Go to <strong>Pappu lab</strong></a></li>
      <li><a href="http://pappulab.wustl.edu/CIDER/">Go to <strong>CIDER</strong> </a></li>
    </ul>